ICAM5 Antikörper (N-Term)

Produktnummer ABIN634713

Produktdetails anti-ICAM5 Antikörper

Target: ICAM5 (Intercellular Adhesion Molecule 5 (ICAM5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ICAM5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ICAM5 antibody was raised against the N terminal of ICAM5

Aufreinigung: Affinity purified

Immunogen: ICAM5 antibody was raised using the N terminal of ICAM5 corresponding to a region with amino acids RRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ICAM5 Blocking Peptide, catalog no. 33R-8151, is also available for use as a blocking control in assays to test for specificity of this ICAM5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICAM5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ICAM5

Target: ICAM5 (Intercellular Adhesion Molecule 5 (ICAM5))

Andere Bezeichnung: ICAM5 (ICAM5 Produkte)

Synonyme: TLCN antikoerper, TLN antikoerper, CD50 antikoerper, ICAM-3 antikoerper, Icam3 antikoerper, Tlcn antikoerper, ICAM5 antikoerper, icam5 antikoerper, tlcn antikoerper, tln antikoerper, intercellular adhesion molecule 5 antikoerper, intercellular adhesion molecule 5, telencephalin antikoerper, intercellular adhesion molecule 5 L homeolog antikoerper, ICAM5 antikoerper, Icam5 antikoerper, LOC100511183 antikoerper, icam5.L antikoerper

Hintergrund: ICAM5 is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is expressed on the surface of telencephalic neurons and displays two types of adhesion activity, homophilic binding between neurons and heterophilic binding between neurons and leukocytes.

Molekulargewicht: 95 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, ER-Nucleus Signaling, Maintenance of Protein Location