PCDHGC4 Antikörper (N-Term)

Produktnummer ABIN634714

Produktdetails anti-PCDHGC4 Antikörper

Target: PCDHGC4 (Protocadherin gamma Subfamily C, 4 (PCDHGC4))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCDHGC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCDHGC4 antibody was raised against the N terminal of PCDHGC4

Aufreinigung: Affinity purified

Immunogen: PCDHGC4 antibody was raised using the N terminal of PCDHGC4 corresponding to a region with amino acids VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDHGC4 Blocking Peptide, catalog no. 33R-9627, is also available for use as a blocking control in assays to test for specificity of this PCDHGC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCDHGC4

Target: PCDHGC4 (Protocadherin gamma Subfamily C, 4 (PCDHGC4))

Andere Bezeichnung: PCDHGC4 (PCDHGC4 Produkte)

Synonyme: PCDH-GAMMA-C4 antikoerper, protocadherin gamma c4 antikoerper, protocadherin gamma subfamily C, 4 antikoerper, Pcdhgc4 antikoerper, PCDHGC4 antikoerper

Hintergrund: PCDHGC4 is a single-pass type I membrane protein. It contains 6 cadherin domains.PCDHGC4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molekulargewicht: 98 kDa (MW of target protein)