Claudin 11 Antikörper
-
- Target Alle Claudin 11 (CLDN11) Antikörper anzeigen
- Claudin 11 (CLDN11)
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Claudin 11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- Claudin 11 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
- Top Product
- Discover our top product CLDN11 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Claudin 11 Blocking Peptide, catalog no. 33R-9803, is also available for use as a blocking control in assays to test for specificity of this Claudin 11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Claudin 11 (CLDN11)
- Andere Bezeichnung
- Claudin 11 (CLDN11 Produkte)
- Hintergrund
- CLDN11 belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.
- Molekulargewicht
- 22 kDa (MW of target protein)
- Pathways
- Hepatitis C
-