CNTNAP3 Antikörper (Middle Region)
-
- Target Alle CNTNAP3 Antikörper anzeigen
- CNTNAP3 (Contactin Associated Protein-Like 3 (CNTNAP3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CNTNAP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CNTNAP3 antibody was raised against the middle region of CNTNAP3
- Aufreinigung
- Affinity purified
- Immunogen
- CNTNAP3 antibody was raised using the middle region of CNTNAP3 corresponding to a region with amino acids GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA
- Top Product
- Discover our top product CNTNAP3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CNTNAP3 Blocking Peptide, catalog no. 33R-3563, is also available for use as a blocking control in assays to test for specificity of this CNTNAP3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CNTNAP3 (Contactin Associated Protein-Like 3 (CNTNAP3))
- Andere Bezeichnung
- CNTNAP3 (CNTNAP3 Produkte)
- Hintergrund
- The protein encoded by this gene belongs to the NCP family of cell-recognition molecules. This family represents a distinct subgroup of the neurexins. NCP proteins mediate neuron-glial interactions in vertebrates and glial-glial contact in invertebrates.
- Molekulargewicht
- 141 kDa (MW of target protein)
-