PCDHGB1 Antikörper (N-Term)

Produktnummer ABIN634720

Produktdetails anti-PCDHGB1 Antikörper

Target: PCDHGB1 (Protocadherin gamma Subfamily B, 1 (PCDHGB1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCDHGB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCDHGB1 antibody was raised against the N terminal of PCDHGB1

Aufreinigung: Affinity purified

Immunogen: PCDHGB1 antibody was raised using the N terminal of PCDHGB1 corresponding to a region with amino acids SPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSGTTHIWIRVTD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDHGB1 Blocking Peptide, catalog no. 33R-8667, is also available for use as a blocking control in assays to test for specificity of this PCDHGB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCDHGB1

Target: PCDHGB1 (Protocadherin gamma Subfamily B, 1 (PCDHGB1))

Andere Bezeichnung: PCDHGB1 (PCDHGB1 Produkte)

Synonyme: PCDH-GAMMA-B1 antikoerper, protocadherin gamma subfamily B, 1 antikoerper, PCDHGB1 antikoerper, Pcdhgb1 antikoerper

Hintergrund: PCDHGB1 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGB1 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molekulargewicht: 85 kDa (MW of target protein)