SIGLEC10 Antikörper (Middle Region)
-
- Target Alle SIGLEC10 Antikörper anzeigen
- SIGLEC10 (Sialic Acid Binding Ig-Like Lectin 10 (SIGLEC10))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SIGLEC10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SIGLEC10 antibody was raised against the middle region of SIGLEC10
- Aufreinigung
- Affinity purified
- Immunogen
- SIGLEC10 antibody was raised using the middle region of SIGLEC10 corresponding to a region with amino acids CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL
- Top Product
- Discover our top product SIGLEC10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SIGLEC10 Blocking Peptide, catalog no. 33R-1714, is also available for use as a blocking control in assays to test for specificity of this SIGLEC10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SIGLEC10 (Sialic Acid Binding Ig-Like Lectin 10 (SIGLEC10))
- Andere Bezeichnung
- SIGLEC10 (SIGLEC10 Produkte)
- Synonyme
- PRO940 antikoerper, SIGLEC-10 antikoerper, SLG2 antikoerper, Siglecg antikoerper, SIGLEC10 antikoerper, slg2 antikoerper, pro940 antikoerper, siglec-10 antikoerper, sialic acid binding Ig like lectin 10 antikoerper, sialic acid binding Ig-like lectin 10 antikoerper, sialic acid-binding Ig-like lectin 10 antikoerper, SIGLEC10 antikoerper, Siglec10 antikoerper, LOC484343 antikoerper, LOC100066644 antikoerper, siglec10 antikoerper, LOC100513863 antikoerper, LOC100340374 antikoerper
- Hintergrund
- SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. SIGLEC10 preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, SIGLEC10 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.
- Molekulargewicht
- 76 kDa (MW of target protein)
-