Claudin 7 Antikörper (Middle Region)
-
- Target Alle Claudin 7 (CLDN7) Antikörper anzeigen
- Claudin 7 (CLDN7)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Claudin 7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Claudin 7 antibody was raised against the middle region of CLDN7
- Aufreinigung
- Affinity purified
- Immunogen
- Claudin 7 antibody was raised using the middle region of CLDN7 corresponding to a region with amino acids GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
- Top Product
- Discover our top product CLDN7 Primärantikörper
-
anti-Claudin 7 (CLDN7) (Tyr210) antibody
CLDN7 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 7 (CLDN7) (AA 172-201), (C-Term) antibodyCLDN7 Reaktivität: Human WB, IHC (p), FACS Wirt: Kaninchen Polyclonal RB23672 unconjugated
anti-Claudin 7 (CLDN7) antibodyCLDN7 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 7 (CLDN7) (C-Term) antibodyCLDN7 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 7 (CLDN7) (AA 29-211) antibodyCLDN7 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 7 (CLDN7) (C-Term) antibodyCLDN7 Reaktivität: Human WB, ELISA, IHC, IHC (p), IP Wirt: Maus Monoclonal unconjugated
anti-Claudin 7 (CLDN7) (C-Term) antibodyCLDN7 Reaktivität: Human, Maus, Hund WB, IHC, IHC (p), IF Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 7 (CLDN7) (AA 179-209), (C-Term) antibodyCLDN7 Reaktivität: Human WB, IHC (p), FACS, EIA Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 7 (CLDN7) antibodyCLDN7 Reaktivität: Human ELISA, IHC Wirt: Maus Monoclonal unconjugated
anti-Claudin 7 (CLDN7) (AA 21-100) antibodyCLDN7 Reaktivität: Human ELISA, IHC (p), IF (cc), IF (p), IHC (fro), ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Claudin 7 Blocking Peptide, catalog no. 33R-3466, is also available for use as a blocking control in assays to test for specificity of this Claudin 7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Claudin 7 (CLDN7)
- Andere Bezeichnung
- Claudin 7 (CLDN7 Produkte)
- Synonyme
- cb388 antikoerper, claudin7 antikoerper, cldn7 antikoerper, wu:fd19f08 antikoerper, MGC53400 antikoerper, MGC75689 antikoerper, CLDN7 antikoerper, CEPTRL2 antikoerper, CLDN-7 antikoerper, CPETRL2 antikoerper, Hs.84359 antikoerper, claudin-1 antikoerper, claudin 7b antikoerper, claudin 7 L homeolog antikoerper, claudin 7 antikoerper, cldn7b antikoerper, cldn7.L antikoerper, cldn7 antikoerper, CLDN7 antikoerper, Cldn7 antikoerper
- Hintergrund
- Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells.
- Molekulargewicht
- 22 kDa (MW of target protein)
- Pathways
- Hepatitis C
-
