PCDHA4 Antikörper (N-Term)
-
- Target Alle PCDHA4 Antikörper anzeigen
- PCDHA4 (Protocadherin alpha 4 (PCDHA4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PCDHA4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PCDHA4 antibody was raised against the N terminal of PCDHA4
- Aufreinigung
- Affinity purified
- Immunogen
- PCDHA4 antibody was raised using the N terminal of PCDHA4 corresponding to a region with amino acids VDRPLQVFHVDVEVRDINDNPPVFPATQKNLSIAESRPLDSRFPLEGASD
- Top Product
- Discover our top product PCDHA4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PCDHA4 Blocking Peptide, catalog no. 33R-9478, is also available for use as a blocking control in assays to test for specificity of this PCDHA4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCDHA4 (Protocadherin alpha 4 (PCDHA4))
- Andere Bezeichnung
- PCDHA4 (PCDHA4 Produkte)
- Synonyme
- CNR1 antikoerper, CNRN1 antikoerper, CRNR1 antikoerper, PCDH-ALPHA4 antikoerper, Cnr1 antikoerper, Crnr1 antikoerper, R75250 antikoerper, PCDHA4 antikoerper, CNRv4 antikoerper, Pcdha4 antikoerper, protocadherin alpha 4 antikoerper, protocadherin alpha-4 antikoerper, PCDHA4 antikoerper, Pcdha4 antikoerper, LOC100713594 antikoerper, LOC100629843 antikoerper
- Hintergrund
- The gene encoding PCDHA4 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences.
- Molekulargewicht
- 99 kDa (MW of target protein)
-