GJD2 Antikörper (Middle Region)
-
- Target Alle GJD2 Antikörper anzeigen
- GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GJD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GJD2 antibody was raised against the middle region of GJD2
- Aufreinigung
- Affinity purified
- Immunogen
- GJD2 antibody was raised using the middle region of GJD2 corresponding to a region with amino acids ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY
- Top Product
- Discover our top product GJD2 Primärantikörper
-
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 99-197) antibody
GJD2 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (Middle Region) antibodyGJD2 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 99-197) antibodyGJD2 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 5E5 unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 201-321) antibodyGJD2 Reaktivität: Ratte WB, ELISA, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 131-180) antibodyGJD2 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (C-Term) antibodyGJD2 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Affe, Schwein, Fledermaus, Hamster, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 159-208) antibodyGJD2 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 291-321), (C-Term) antibodyGJD2 Reaktivität: Human, Maus, Ratte WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 170-182), (Intracellular) antibodyGJD2 Reaktivität: Maus, Ratte WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 292-321), (C-Term) antibodyGJD2 Reaktivität: Human WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GJD2 Blocking Peptide, catalog no. 33R-2564, is also available for use as a blocking control in assays to test for specificity of this GJD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))
- Andere Bezeichnung
- GJD2 (GJD2 Produkte)
- Synonyme
- CX36 antikoerper, GJA9 antikoerper, Cx35.1 antikoerper, Cx36 antikoerper, GJD2 antikoerper, Gja9 antikoerper, connexin36 antikoerper, cx36 antikoerper, gap junction protein delta 2 antikoerper, gap junction protein, delta 2 antikoerper, GJD2 antikoerper, Gjd2 antikoerper
- Hintergrund
- GJD2 is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.
- Molekulargewicht
- 36 kDa (MW of target protein)
-
