PCDHA4 Antikörper (C-Term)

Produktnummer ABIN634737

Produktdetails anti-PCDHA4 Antikörper

Target: PCDHA4 (Protocadherin alpha 4 (PCDHA4))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCDHA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCDHA4 antibody was raised against the C terminal of PCDHA4

Aufreinigung: Affinity purified

Immunogen: PCDHA4 antibody was raised using the C terminal of PCDHA4 corresponding to a region with amino acids SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDHA4 Blocking Peptide, catalog no. 33R-8505, is also available for use as a blocking control in assays to test for specificity of this PCDHA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCDHA4

Target: PCDHA4 (Protocadherin alpha 4 (PCDHA4))

Andere Bezeichnung: PCDHA4 (PCDHA4 Produkte)

Synonyme: CNR1 antikoerper, CNRN1 antikoerper, CRNR1 antikoerper, PCDH-ALPHA4 antikoerper, Cnr1 antikoerper, Crnr1 antikoerper, R75250 antikoerper, PCDHA4 antikoerper, CNRv4 antikoerper, Pcdha4 antikoerper, protocadherin alpha 4 antikoerper, protocadherin alpha-4 antikoerper, PCDHA4 antikoerper, Pcdha4 antikoerper, LOC100713594 antikoerper, LOC100629843 antikoerper

Hintergrund: The gene encoding PCDHA4 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molekulargewicht: 99 kDa (MW of target protein)