PCDHA10 Antikörper (N-Term)

Produktnummer ABIN634738

Produktdetails anti-PCDHA10 Antikörper

Target: PCDHA10 (Protocadherin alpha 10 (PCDHA10))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCDHA10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCDHA10 antibody was raised against the N terminal of PCDHA10

Aufreinigung: Affinity purified

Immunogen: PCDHA10 antibody was raised using the N terminal of PCDHA10 corresponding to a region with amino acids ESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDHA10 Blocking Peptide, catalog no. 33R-2743, is also available for use as a blocking control in assays to test for specificity of this PCDHA10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCDHA10

Target: PCDHA10 (Protocadherin alpha 10 (PCDHA10))

Andere Bezeichnung: PCDHA10 (PCDHA10 Produkte)

Synonyme: CNR8 antikoerper, CNRN8 antikoerper, CNRS8 antikoerper, CRNR8 antikoerper, PCDH-ALPHA10 antikoerper, Cnr3 antikoerper, Cnr8 antikoerper, Crnr3 antikoerper, Crnr8 antikoerper, Pcdha14 antikoerper, rCNRv10 antikoerper, protocadherin alpha 10 antikoerper, PCDHA10 antikoerper, Pcdha10 antikoerper

Hintergrund: This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster.

Molekulargewicht: 89 kDa (MW of target protein)