PCDHA10 Antikörper (N-Term)
-
- Target Alle PCDHA10 Antikörper anzeigen
- PCDHA10 (Protocadherin alpha 10 (PCDHA10))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PCDHA10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PCDHA10 antibody was raised against the N terminal of PCDHA10
- Aufreinigung
- Affinity purified
- Immunogen
- PCDHA10 antibody was raised using the N terminal of PCDHA10 corresponding to a region with amino acids DKDKFPVLVLRKLLDREENPQLKLLLTATDGGKPEFTGSVSLLILVLDAN
- Top Product
- Discover our top product PCDHA10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PCDHA10 Blocking Peptide, catalog no. 33R-2014, is also available for use as a blocking control in assays to test for specificity of this PCDHA10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCDHA10 (Protocadherin alpha 10 (PCDHA10))
- Andere Bezeichnung
- PCDHA10 (PCDHA10 Produkte)
- Synonyme
- CNR8 antikoerper, CNRN8 antikoerper, CNRS8 antikoerper, CRNR8 antikoerper, PCDH-ALPHA10 antikoerper, Cnr3 antikoerper, Cnr8 antikoerper, Crnr3 antikoerper, Crnr8 antikoerper, Pcdha14 antikoerper, rCNRv10 antikoerper, protocadherin alpha 10 antikoerper, PCDHA10 antikoerper, Pcdha10 antikoerper
- Hintergrund
- This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster.
- Molekulargewicht
- 73 kDa (MW of target protein)
-