PCDHA5 Antikörper (N-Term)

Produktnummer ABIN634740

Produktdetails anti-PCDHA5 Antikörper

Target: PCDHA5 (Protocadherin alpha 5 (PCDHA5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCDHA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCDHA5 antibody was raised against the N terminal of PCDHA5

Aufreinigung: Affinity purified

Immunogen: PCDHA5 antibody was raised using the N terminal of PCDHA5 corresponding to a region with amino acids VYSRRGSLGSRLLLLWLLLAYWKAGSGQLHYSIPEEAKHGTFVGRIAQDL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDHA5 Blocking Peptide, catalog no. 33R-9928, is also available for use as a blocking control in assays to test for specificity of this PCDHA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCDHA5

Target: PCDHA5 (Protocadherin alpha 5 (PCDHA5))

Andere Bezeichnung: PCDHA5 (PCDHA5 Produkte)

Synonyme: CNR6 antikoerper, CNRN6 antikoerper, CNRS6 antikoerper, CRNR6 antikoerper, PCDH-ALPHA5 antikoerper, Cnr6 antikoerper, Crnr6 antikoerper, rCNRv05 antikoerper, PCDHA5 antikoerper, Pcdha5 antikoerper, protocadherin alpha 5 antikoerper, protocadherin alpha-5 antikoerper, PCDHA5 antikoerper, Pcdha5 antikoerper, LOC100738784 antikoerper, LOC100847156 antikoerper, LOC100713870 antikoerper, LOC100629824 antikoerper

Hintergrund: The gene encoding PCDHA5 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA5 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA5 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molekulargewicht: 99 kDa (MW of target protein)