PCDHA6 Antikörper (C-Term)
-
- Target Alle PCDHA6 Antikörper anzeigen
- PCDHA6 (Protocadherin alpha 6 (PCDHA6))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PCDHA6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PCDHA6 antibody was raised against the C terminal of PCDHA6
- Aufreinigung
- Affinity purified
- Immunogen
- PCDHA6 antibody was raised using the C terminal of PCDHA6 corresponding to a region with amino acids LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY
- Top Product
- Discover our top product PCDHA6 Primärantikörper
-
anti-Protocadherin alpha 6 (PCDHA6) (AA 295-370) antibody
PCDHA6 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1A3 unconjugated
anti-Protocadherin alpha 6 (PCDHA6) (AA 1-230) antibodyPCDHA6 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Protocadherin alpha 6 (PCDHA6) (AA 1-230) antibodyPCDHA6 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Protocadherin alpha 6 (PCDHA6) antibodyPCDHA6 Reaktivität: Human, Ratte, Maus IF Wirt: Kaninchen Polyclonal unconjugated
anti-Protocadherin alpha 6 (PCDHA6) (AA 1-950) antibodyPCDHA6 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protocadherin alpha 6 (PCDHA6) (AA 1-950) antibodyPCDHA6 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Protocadherin alpha 6 (PCDHA6) (AA 650-699) antibodyPCDHA6 Reaktivität: Human, Ratte, Meerschweinchen, Pferd, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protocadherin alpha 6 (PCDHA6) (AA 84-387) antibodyPCDHA6 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PCDHA6 Blocking Peptide, catalog no. 33R-5518, is also available for use as a blocking control in assays to test for specificity of this PCDHA6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCDHA6 (Protocadherin alpha 6 (PCDHA6))
- Andere Bezeichnung
- PCDHA6 (PCDHA6 Produkte)
- Synonyme
- CNR2 antikoerper, CNRN2 antikoerper, CNRS2 antikoerper, CRNR2 antikoerper, PCDH-ALPHA6 antikoerper, CNR antikoerper, Cnr2 antikoerper, Crnr2 antikoerper, rCNRv06 antikoerper, PCDHA3 antikoerper, PCDHA6 antikoerper, PCDHA7 antikoerper, PCDHA9 antikoerper, protocadherin alpha 6 antikoerper, PCDHA6 antikoerper, Pcdha6 antikoerper
- Hintergrund
- PCDHA6 contains 6 cadherin domains. It is a potential calcium-dependent cell-adhesion protein. PCDHA6 may be involved in the establishment and maintenance of specific neuronal connections in the brain.
- Molekulargewicht
- 84 kDa (MW of target protein)
-
