GJC2 Antikörper (Middle Region)
-
- Target Alle GJC2 Antikörper anzeigen
- GJC2 (Gap Junction Protein, gamma 2, 47kDa (GJC2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GJC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GJC2 antibody was raised against the middle region of GJC2
- Aufreinigung
- Affinity purified
- Immunogen
- GJC2 antibody was raised using the middle region of GJC2 corresponding to a region with amino acids APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW
- Top Product
- Discover our top product GJC2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GJC2 Blocking Peptide, catalog no. 33R-1416, is also available for use as a blocking control in assays to test for specificity of this GJC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GJC2 (Gap Junction Protein, gamma 2, 47kDa (GJC2))
- Andere Bezeichnung
- GJC2 (GJC2 Produkte)
- Synonyme
- GJA12 antikoerper, cx47 antikoerper, gja12 antikoerper, cx46.6 antikoerper, pmldar antikoerper, MGC146420 antikoerper, B230382L12Rik antikoerper, Cx47 antikoerper, Gja12 antikoerper, CX46.6 antikoerper, HLD2 antikoerper, LMPH1C antikoerper, PMLDAR antikoerper, SPG44 antikoerper, gap junction protein gamma 2 antikoerper, si:dkey-91f15.1 antikoerper, gap junction protein, gamma 2 antikoerper, GJC2 antikoerper, gjc2 antikoerper, si:dkey-91f15.1 antikoerper, Gjc2 antikoerper
- Hintergrund
- GJC2 is a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans.
- Molekulargewicht
- 47 kDa (MW of target protein)
-