Claudin 15 Antikörper (Middle Region)
-
- Target Alle Claudin 15 (CLDN15) Antikörper anzeigen
- Claudin 15 (CLDN15)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Claudin 15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Claudin 15 antibody was raised against the middle region of CLDN15
- Aufreinigung
- Affinity purified
- Immunogen
- Claudin 15 antibody was raised using the middle region of CLDN15 corresponding to a region with amino acids LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA
- Top Product
- Discover our top product CLDN15 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Claudin 15 Blocking Peptide, catalog no. 33R-5429, is also available for use as a blocking control in assays to test for specificity of this Claudin 15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Claudin 15 (CLDN15)
- Andere Bezeichnung
- Claudin 15 (CLDN15 Produkte)
- Synonyme
- CLDN15 antikoerper, cldn15 antikoerper, cldn15l antikoerper, zgc:63943 antikoerper, zgc:136755 antikoerper, 2210009B08Rik antikoerper, BB107105 antikoerper, claudin 15 antikoerper, claudin 15a antikoerper, claudin 15b antikoerper, Cldn15 antikoerper, CLDN15 antikoerper, cldn15a antikoerper, cldn15b antikoerper
- Hintergrund
- CLDN15 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
- Molekulargewicht
- 24 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Hepatitis C
-