ITFG1 Antikörper (N-Term)

Produktnummer ABIN634749

Produktdetails anti-ITFG1 Antikörper

Target: ITFG1 (Integrin alpha FG-GAP Repeat Containing 1 (ITFG1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ITFG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ITFG1 antibody was raised against the N terminal of ITFG1

Aufreinigung: Affinity purified

Immunogen: ITFG1 antibody was raised using the N terminal of ITFG1 corresponding to a region with amino acids TAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQNAPYFKP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ITFG1 Blocking Peptide, catalog no. 33R-8970, is also available for use as a blocking control in assays to test for specificity of this ITFG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITFG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ITFG1

Target: ITFG1 (Integrin alpha FG-GAP Repeat Containing 1 (ITFG1))

Andere Bezeichnung: ITFG1 (ITFG1 Produkte)

Synonyme: ITFG1 antikoerper, DKFZp459J0328 antikoerper, TIP antikoerper, 2310047C21Rik antikoerper, AI314457 antikoerper, Cda08 antikoerper, D8Wsu49e antikoerper, integrin alpha FG-GAP repeat containing 1 antikoerper, T-cell immunomodulatory protein antikoerper, ITFG1 antikoerper, itfg1 antikoerper, LOC100550296 antikoerper, Itfg1 antikoerper

Hintergrund: ITFG1 belongs to the TIP family. It contains 1 FG-GAP repeat. ITFG1 is a modulator of T-cell function. It has a protective effect in graft versus host disease model.

Molekulargewicht: 68 kDa (MW of target protein)