ITGB8 Antikörper (C-Term)
-
- Target Alle ITGB8 Antikörper anzeigen
- ITGB8 (Integrin beta-8 (ITGB8))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ITGB8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Integrin Beta 8 antibody was raised against the C terminal of ITGB8
- Aufreinigung
- Affinity purified
- Immunogen
- Integrin Beta 8 antibody was raised using the C terminal of ITGB8 corresponding to a region with amino acids CTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCAL
- Top Product
- Discover our top product ITGB8 Primärantikörper
-
anti-Integrin beta-8 (ITGB8) (AA 392-503) antibody
ITGB8 Reaktivität: Human WB, ELISA, IP Wirt: Maus Monoclonal 2B4 unconjugated
anti-Integrin beta-8 (ITGB8) (AA 471-629) antibodyITGB8 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Integrin beta-8 (ITGB8) antibodyITGB8 Reaktivität: Human, Maus, Ratte WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Integrin beta-8 (ITGB8) (AA 43-320) antibodyITGB8 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Integrin beta-8 (ITGB8) (AA 197-231) antibodyITGB8 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB51854 unconjugated
anti-Integrin beta-8 (ITGB8) (C-Term) antibodyITGB8 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Integrin beta-8 (ITGB8) (C-Term) antibodyITGB8 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Schwein, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Integrin beta-8 (ITGB8) (AA 197-231) antibodyITGB8 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Integrin beta-8 (ITGB8) (Internal Region) antibodyITGB8 Reaktivität: Human, Maus WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Integrin beta-8 (ITGB8) (AA 392-503) antibodyITGB8 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Integrin Beta 8 Blocking Peptide, catalog no. 33R-1821, is also available for use as a blocking control in assays to test for specificity of this Integrin Beta 8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ITGB8 (Integrin beta-8 (ITGB8))
- Andere Bezeichnung
- Integrin beta 8 (ITGB8 Produkte)
- Synonyme
- 4832412O06Rik antikoerper, integrin beta 8 antikoerper, integrin subunit beta 8 antikoerper, Itgb8 antikoerper, ITGB8 antikoerper
- Hintergrund
- ITGB8 is a member of the integrin beta chain family and is a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In general, integrin complexes mediate cell-cell and cell-extracellular matrix interactions and this complex plays a role in human airway epithelial proliferation.
- Molekulargewicht
- 81 kDa (MW of target protein)
-
