Cadherin 7 Antikörper (N-Term)

Produktnummer ABIN634751

Produktdetails anti-Cadherin 7 Antikörper

Target: Cadherin 7 (CDH7)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cadherin 7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CDH7 antibody was raised against the N terminal of CDH7

Aufreinigung: Affinity purified

Immunogen: CDH7 antibody was raised using the N terminal of CDH7 corresponding to a region with amino acids PKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQP

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDH7 Blocking Peptide, catalog no. 33R-7167, is also available for use as a blocking control in assays to test for specificity of this CDH7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cadherin 7

Target: Cadherin 7 (CDH7)

Andere Bezeichnung: CDH7 (CDH7 Produkte)

Synonyme: CDH7L1 antikoerper, Cad7 antikoerper, 9330156F07Rik antikoerper, cadherin 7 antikoerper, cadherin 7, type 2 antikoerper, cadherin 7a antikoerper, CDH7 antikoerper, Cdh7 antikoerper, cdh7a antikoerper

Hintergrund: CDH7 is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures.

Molekulargewicht: 82 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization