Protocadherin 8 Antikörper (Middle Region)

Produktnummer ABIN634753

Produktdetails anti-Protocadherin 8 Antikörper

Target: Protocadherin 8 (PCDH8)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Protocadherin 8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCDH8 antibody was raised against the middle region of PCDH8

Aufreinigung: Affinity purified

Immunogen: PCDH8 antibody was raised using the middle region of PCDH8 corresponding to a region with amino acids GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDH8 Blocking Peptide, catalog no. 33R-3177, is also available for use as a blocking control in assays to test for specificity of this PCDH8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Protocadherin 8

Target: Protocadherin 8 (PCDH8)

Andere Bezeichnung: PCDH8 (PCDH8 Produkte)

Synonyme: papc antikoerper, xpapc antikoerper, protocadherin-8 antikoerper, ARCADLIN antikoerper, PAPC antikoerper, 1700080P15Rik antikoerper, Papc antikoerper, Arcadlin antikoerper, protocadherin 8 antikoerper, protocadherin 8 L homeolog antikoerper, protocadherin-8 antikoerper, PCDH8 antikoerper, pcdh8.L antikoerper, LOC485469 antikoerper, Pcdh8 antikoerper, LOC100155738 antikoerper

Hintergrund: This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. PCDH8 is an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region.

Molekulargewicht: 101 kDa (MW of target protein)