LYVE1 Antikörper (N-Term)
-
- Target Alle LYVE1 Antikörper anzeigen
- LYVE1 (Lymphatic Vessel Endothelial Hyaluronan Receptor 1 (LYVE1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LYVE1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LYVE1 antibody was raised against the N terminal of LYVE1
- Aufreinigung
- Affinity purified
- Immunogen
- LYVE1 antibody was raised using the N terminal of LYVE1 corresponding to a region with amino acids ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ
- Top Product
- Discover our top product LYVE1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LYVE1 Blocking Peptide, catalog no. 33R-1461, is also available for use as a blocking control in assays to test for specificity of this LYVE1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYVE1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Identification of lymphatics in the ciliary body of the human eye: a novel "uveolymphatic" outflow pathway." in: Experimental eye research, Vol. 89, Issue 5, pp. 810-9, (2009) (PubMed).
: "
-
Identification of lymphatics in the ciliary body of the human eye: a novel "uveolymphatic" outflow pathway." in: Experimental eye research, Vol. 89, Issue 5, pp. 810-9, (2009) (PubMed).
-
- Target
- LYVE1 (Lymphatic Vessel Endothelial Hyaluronan Receptor 1 (LYVE1))
- Andere Bezeichnung
- LYVE1 (LYVE1 Produkte)
- Synonyme
- LYVE1 antikoerper, XLKD1 antikoerper, CRSBP-1 antikoerper, HAR antikoerper, LYVE-1 antikoerper, 1200012G08Rik antikoerper, Crsbp-1 antikoerper, Lyve-1 antikoerper, Xlkd1 antikoerper, lymphatic vessel endothelial hyaluronic receptor 1a antikoerper, lymphatic vessel endothelial hyaluronan receptor 1 antikoerper, lyve1a antikoerper, LYVE1 antikoerper, Lyve1 antikoerper
- Hintergrund
- LYVE1 is a type I integral membrane glycoprotein. It acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-