SIGLEC9 Antikörper (C-Term)

Produktnummer ABIN634755

Produktdetails anti-SIGLEC9 Antikörper

Target: SIGLEC9 (Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIGLEC9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SIGLEC9 antibody was raised against the C terminal of SIGLEC9

Aufreinigung: Affinity purified

Immunogen: SIGLEC9 antibody was raised using the C terminal of SIGLEC9 corresponding to a region with amino acids PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SIGLEC9 Blocking Peptide, catalog no. 33R-7438, is also available for use as a blocking control in assays to test for specificity of this SIGLEC9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SIGLEC9

Target: SIGLEC9 (Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9))

Andere Bezeichnung: SIGLEC9 (SIGLEC9 Produkte)

Synonyme: CD329 antikoerper, CDw329 antikoerper, FOAP-9 antikoerper, OBBP-LIKE antikoerper, siglec-9 antikoerper, siglec9 antikoerper, sialic acid binding Ig like lectin 9 antikoerper, sialic acid-binding immunoglobulin-like lectin 9 antikoerper, SIGLEC9 antikoerper

Hintergrund: SIGLEC9 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. It preferentially binds to alpha2,3- or 2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

Molekulargewicht: 50 kDa (MW of target protein)