Claudin 19 Antikörper (C-Term)
-
- Target Alle Claudin 19 (CLDN19) Antikörper anzeigen
- Claudin 19 (CLDN19)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Claudin 19 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Claudin 19 antibody was raised against the C terminal of CLDN19
- Aufreinigung
- Affinity purified
- Immunogen
- Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV
- Top Product
- Discover our top product CLDN19 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Claudin 19 Blocking Peptide, catalog no. 33R-1605, is also available for use as a blocking control in assays to test for specificity of this Claudin 19 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN19 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Claudin 19 (CLDN19)
- Andere Bezeichnung
- Claudin 19 (CLDN19 Produkte)
- Synonyme
- HOMG5 antikoerper, claudin-19 antikoerper, zgc:112141 antikoerper, claudin 19 antikoerper, claudin 19 S homeolog antikoerper, CLDN19 antikoerper, Cldn19 antikoerper, cldn19.S antikoerper, cldn19 antikoerper
- Hintergrund
- CLDN19 belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO).
- Molekulargewicht
- 23 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Hepatitis C
-