BMP6 Antikörper (Middle Region)

Produktnummer ABIN634774

Produktdetails anti-BMP6 Antikörper

Target: BMP6 (Bone Morphogenetic Protein 6 (BMP6))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BMP6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BMP6 antibody was raised against the middle region of BMP6

Aufreinigung: Affinity purified

Immunogen: BMP6 antibody was raised using the middle region of BMP6 corresponding to a region with amino acids MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BMP6 Blocking Peptide, catalog no. 33R-6576, is also available for use as a blocking control in assays to test for specificity of this BMP6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BMP6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BMP6

Target: BMP6 (Bone Morphogenetic Protein 6 (BMP6))

Andere Bezeichnung: BMP6 (BMP6 Produkte)

Synonyme: BMP6 antikoerper, zgc:113595 antikoerper, vgr antikoerper, vgr-1 antikoerper, vgr1 antikoerper, VGR antikoerper, VGR1 antikoerper, D13Wsu115e antikoerper, Vgr1 antikoerper, bone morphogenetic protein 6 antikoerper, bone morphogenetic protein 6 S homeolog antikoerper, BMP6 antikoerper, bmp6 antikoerper, bmp6.S antikoerper, Bmp6 antikoerper

Hintergrund: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process