OSGIN1 Antikörper (N-Term)

Produktnummer ABIN634776

Produktdetails anti-OSGIN1 Antikörper

Target: OSGIN1 (Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OSGIN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OSGIN1 antibody was raised against the N terminal of OSGIN1

Aufreinigung: Affinity purified

Immunogen: OSGIN1 antibody was raised using the N terminal of OSGIN1 corresponding to a region with amino acids APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OSGIN1 Blocking Peptide, catalog no. 33R-1422, is also available for use as a blocking control in assays to test for specificity of this OSGIN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSGIN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OSGIN1

Target: OSGIN1 (Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1))

Andere Bezeichnung: OSGIN1 (OSGIN1 Produkte)

Synonyme: 1700012B18Rik antikoerper, Okl38 antikoerper, 1700012B18RIK antikoerper, BDGI antikoerper, OKL38 antikoerper, oxidative stress induced growth inhibitor 1 antikoerper, OSGIN1 antikoerper, Osgin1 antikoerper

Hintergrund: OSGIN1 regulates the differentiation and proliferation of normal cells through the regulation of cell death.

Molekulargewicht: 61 kDa (MW of target protein)