COPA Antikörper (N-Term)

Produktnummer ABIN634777

Produktdetails anti-COPA Antikörper

Target: COPA (Coatomer Protein Complex, Subunit alpha (COPA))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COPA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: COPA antibody was raised against the N terminal of COPA

Aufreinigung: Affinity purified

Immunogen: COPA antibody was raised using the N terminal of COPA corresponding to a region with amino acids PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COPA Blocking Peptide, catalog no. 33R-7432, is also available for use as a blocking control in assays to test for specificity of this COPA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COPA

Target: COPA (Coatomer Protein Complex, Subunit alpha (COPA))

Andere Bezeichnung: COPA (COPA Produkte)

Hintergrund: In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone.

Molekulargewicht: 135 kDa (MW of target protein)

Pathways: Hormone Activity