Norrie Disease (Pseudoglioma) Antikörper
-
- Target Alle Norrie Disease (Pseudoglioma) (NDP) Antikörper anzeigen
- Norrie Disease (Pseudoglioma) (NDP)
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Norrie Disease (Pseudoglioma) Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NDP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV
- Top Product
- Discover our top product NDP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NDP Blocking Peptide, catalog no. 33R-2114, is also available for use as a blocking control in assays to test for specificity of this NDP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Norrie Disease (Pseudoglioma) (NDP)
- Andere Bezeichnung
- NDP (NDP Produkte)
- Hintergrund
- NDP activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. NDP plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. NDP acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1).
- Molekulargewicht
- 15 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-