Stanniocalcin 1 Antikörper (N-Term)
-
- Target Alle Stanniocalcin 1 (STC1) Antikörper anzeigen
- Stanniocalcin 1 (STC1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Stanniocalcin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- STC1 antibody was raised against the N terminal of STC1
- Aufreinigung
- Affinity purified
- Immunogen
- STC1 antibody was raised using the N terminal of STC1 corresponding to a region with amino acids MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL
- Top Product
- Discover our top product STC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
STC1 Blocking Peptide, catalog no. 33R-6205, is also available for use as a blocking control in assays to test for specificity of this STC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Stanniocalcin 1 (STC1)
- Andere Bezeichnung
- STC1 (STC1 Produkte)
- Hintergrund
- STC1 is a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. It contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate.
- Molekulargewicht
- 26 kDa (MW of target protein)
- Pathways
- Hormone Activity
-