PDGFD Antikörper (N-Term)

Produktnummer ABIN634793

Produktdetails anti-PDGFD Antikörper

Target: PDGFD (Platelet Derived Growth Factor D (PDGFD))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDGFD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PDGFD antibody was raised against the N terminal of PDGFD

Aufreinigung: Affinity purified

Immunogen: PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDGFD Blocking Peptide, catalog no. 33R-6641, is also available for use as a blocking control in assays to test for specificity of this PDGFD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDGFD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDGFD

Target: PDGFD (Platelet Derived Growth Factor D (PDGFD))

Andere Bezeichnung: PDGFD (PDGFD Produkte)

Synonyme: IEGF antikoerper, SCDGF-B antikoerper, SCDGFB antikoerper, Scdgfb antikoerper, rSCDGF-B antikoerper, PDGFD antikoerper, 1110003I09Rik antikoerper, platelet derived growth factor D antikoerper, platelet-derived growth factor, D polypeptide antikoerper, PDGFD antikoerper, Pdgfd antikoerper

Hintergrund: The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: RTK Signalweg, Platelet-derived growth Factor Receptor Signaling