AMH Antikörper (Middle Region)
-
- Target Alle AMH Antikörper anzeigen
- AMH (Anti-Mullerian Hormone (AMH))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AMH Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AMH antibody was raised against the middle region of AMH
- Aufreinigung
- Affinity purified
- Immunogen
- AMH antibody was raised using the middle region of AMH corresponding to a region with amino acids SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG
- Top Product
- Discover our top product AMH Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AMH Blocking Peptide, catalog no. 33R-8906, is also available for use as a blocking control in assays to test for specificity of this AMH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AMH (Anti-Mullerian Hormone (AMH))
- Andere Bezeichnung
- AMH (AMH Produkte)
- Synonyme
- AMH antikoerper, amh antikoerper, MIF antikoerper, MIS antikoerper, anti-Mullerian hormone antikoerper, amh antikoerper, AMH antikoerper, Amh antikoerper
- Hintergrund
- Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion
-