LEFTY2 Antikörper (N-Term)

Produktnummer ABIN634801

Produktdetails anti-LEFTY2 Antikörper

Target: LEFTY2 (Left-Right Determination Factor 2 (LEFTY2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LEFTY2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LEFTY2 antibody was raised against the N terminal of LEFTY2

Aufreinigung: Affinity purified

Immunogen: LEFTY2 antibody was raised using the N terminal of LEFTY2 corresponding to a region with amino acids MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LEFTY2 Blocking Peptide, catalog no. 33R-6619, is also available for use as a blocking control in assays to test for specificity of this LEFTY2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEFTY2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LEFTY2

Target: LEFTY2 (Left-Right Determination Factor 2 (LEFTY2))

Andere Bezeichnung: LEFTY2 (LEFTY2 Produkte)

Hintergrund: LEFTY2 is a member of the TGF-beta family of proteins. The protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in its gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of its gene in the endometrium.

Molekulargewicht: 40 kDa (MW of target protein)