Hepcidin Antikörper (N-Term)
-
- Target Alle Hepcidin (HAMP) Antikörper anzeigen
- Hepcidin (HAMP) (Hepcidin Antimicrobial Peptide (HAMP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Hepcidin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HAMP antibody was raised against the N terminal of HAMP
- Aufreinigung
- Affinity purified
- Immunogen
- HAMP antibody was raised using the N terminal of HAMP corresponding to a region with amino acids MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM
- Top Product
- Discover our top product HAMP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HAMP Blocking Peptide, catalog no. 33R-5697, is also available for use as a blocking control in assays to test for specificity of this HAMP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAMP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Contribution of three-dimensional architecture and tumor-associated fibroblasts to hepcidin regulation in breast cancer." in: Oncogene, Vol. 37, Issue 29, pp. 4013-4032, (2019) (PubMed).
: "
-
Contribution of three-dimensional architecture and tumor-associated fibroblasts to hepcidin regulation in breast cancer." in: Oncogene, Vol. 37, Issue 29, pp. 4013-4032, (2019) (PubMed).
-
- Target
- Hepcidin (HAMP) (Hepcidin Antimicrobial Peptide (HAMP))
- Andere Bezeichnung
- HAMP (HAMP Produkte)
- Hintergrund
- The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption.
- Molekulargewicht
- 9 kDa (MW of target protein)
- Pathways
- Hormone Activity, Transition Metal Ion Homeostasis
-