Peptide YY Antikörper (Middle Region)

Produktnummer ABIN634817

Produktdetails anti-Peptide YY Antikörper

Target: Peptide YY (PYY)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Peptide YY Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PYY antibody was raised against the middle region of PYY

Aufreinigung: Affinity purified

Immunogen: PYY antibody was raised using the middle region of PYY corresponding to a region with amino acids APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PYY Blocking Peptide, catalog no. 33R-1436, is also available for use as a blocking control in assays to test for specificity of this PYY antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYY antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Peptide YY

Target: Peptide YY (PYY)

Andere Bezeichnung: PYY (PYY Produkte)

Synonyme: PYY-I antikoerper, PYY1 antikoerper, GHYY antikoerper, RATGHYY antikoerper, Yy antikoerper, peptide-YY antikoerper, peptide YY antikoerper, peptide YY (mapped) antikoerper, PYY antikoerper, Pyy antikoerper

Hintergrund: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.

Molekulargewicht: 11 kDa (MW of target protein)