PODXL Antikörper (Middle Region)
-
- Target Alle PODXL Antikörper anzeigen
- PODXL (Podocalyxin-Like (PODXL))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PODXL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PODXL antibody was raised against the middle region of PODXL
- Aufreinigung
- Affinity purified
- Immunogen
- PODXL antibody was raised using the middle region of PODXL corresponding to a region with amino acids PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ
- Top Product
- Discover our top product PODXL Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PODXL Blocking Peptide, catalog no. 33R-6983, is also available for use as a blocking control in assays to test for specificity of this PODXL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PODXL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PODXL (Podocalyxin-Like (PODXL))
- Andere Bezeichnung
- PODXL (PODXL Produkte)
- Synonyme
- Gp200 antikoerper, PC antikoerper, PCLP antikoerper, PCLP-1 antikoerper, PCB antikoerper, AW121214 antikoerper, Ly102 antikoerper, Pclp1 antikoerper, podocalyxin antikoerper, MEP21 antikoerper, PODXL antikoerper, Gp135 antikoerper, PCLP1 antikoerper, cPCLP1 antikoerper, podxl antikoerper, fc18d02 antikoerper, wu:fc18d02 antikoerper, Pc antikoerper, Pcb antikoerper, Podxl antikoerper, podocalyxin like antikoerper, pyruvate carboxylase antikoerper, podocalyxin-like antikoerper, PODXL antikoerper, PC antikoerper, Podxl antikoerper, podxl antikoerper, Pcx antikoerper
- Hintergrund
- PODXL is a member of the sialomucin protein family. PODXL was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Tube Formation
-