FMO4 Antikörper (N-Term)

Produktnummer ABIN634825

Produktdetails anti-FMO4 Antikörper

Target: FMO4 (Flavin Containing Monooxygenase 4 (FMO4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FMO4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FMO4 antibody was raised against the N terminal of FMO4

Aufreinigung: Affinity purified

Immunogen: FMO4 antibody was raised using the N terminal of FMO4 corresponding to a region with amino acids MVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPEGFQGKRVLVIGLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FMO4 Blocking Peptide, catalog no. 33R-6578, is also available for use as a blocking control in assays to test for specificity of this FMO4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FMO4

Target: FMO4 (Flavin Containing Monooxygenase 4 (FMO4))

Andere Bezeichnung: FMO4 (FMO4 Produkte)

Synonyme: FMO2 antikoerper, D1Ertd532e antikoerper, flavin containing monooxygenase 4 antikoerper, FMO4 antikoerper, Fmo4 antikoerper

Hintergrund: FMO4 belongs to the FMO family. Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region.

Molekulargewicht: 63 kDa (MW of target protein)