MCTP1 Antikörper (Middle Region)
-
- Target Alle MCTP1 Produkte
- MCTP1 (Multiple C2 Domains, Transmembrane 1 (MCTP1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MCTP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MCTP1 antibody was raised against the middle region of MCTP1
- Aufreinigung
- Affinity purified
- Immunogen
- MCTP1 antibody was raised using the middle region of MCTP1 corresponding to a region with amino acids LVWGINKFTKKLRSPYAIDNNELLDFLSRVPSDVQVVQYQELKPDPSHSP
-
anti-Multiple C2 Domains, Transmembrane 1 (MCTP1) (C-Term) antibody
MCTP1 Reaktivität: Human, Maus, Meerschweinchen, Pferd, Zebrafisch (Danio rerio), Huhn, Affe, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Multiple C2 Domains, Transmembrane 1 (MCTP1) (Middle Region) antibodyMCTP1 Reaktivität: Human, Maus, Meerschweinchen, Pferd, Ratte, Zebrafisch (Danio rerio), Hund, Rind (Kuh), Kaninchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Multiple C2 Domains, Transmembrane 1 (MCTP1) (AA 1-600) antibodyMCTP1 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Multiple C2 Domains, Transmembrane 1 (MCTP1) (AA 468-517) antibodyMCTP1 Reaktivität: Human, Maus, Meerschweinchen, Pferd, Zebrafisch (Danio rerio), Hund, Huhn, Affe, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Multiple C2 Domains, Transmembrane 1 (MCTP1) (N-Term) antibodyMCTP1 Reaktivität: Human, Maus, Meerschweinchen, Pferd, Ratte, Zebrafisch (Danio rerio), Hund, Rind (Kuh), Kaninchen, Saccharomyces cerevisiae WB Wirt: Kaninchen Polyclonal unconjugated
anti-Multiple C2 Domains, Transmembrane 1 (MCTP1) antibodyMCTP1 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MCTP1 Blocking Peptide, catalog no. 33R-5550, is also available for use as a blocking control in assays to test for specificity of this MCTP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCTP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MCTP1 (Multiple C2 Domains, Transmembrane 1 (MCTP1))
- Andere Bezeichnung
- MCTP1 (MCTP1 Produkte)
- Synonyme
- MGC157203 antikoerper, MGC108303 antikoerper, 2810465F10Rik antikoerper, Mctp1-ps1 antikoerper, RGD1305199 antikoerper, multiple C2 and transmembrane domain containing 1 antikoerper, multiple C2 domains, transmembrane 1 antikoerper, MCTP1 antikoerper, mctp1 antikoerper, Mctp1 antikoerper
- Hintergrund
- MCTP1 belongs to the MCTP family.It contains 3 C2 domains. MCTP1 is a multi-pass membrane protein. It binds calcium via the C2 domains in absence of phospholipids. The function of MCTP1 remains unknown.
- Molekulargewicht
- 89 kDa (MW of target protein)
-
