SLC39A7 Antikörper

Produktnummer ABIN634829

Produktdetails anti-SLC39A7 Antikörper

Target: SLC39A7 (Solute Carrier Family 39 (Zinc Transporter), Member 7 (SLC39A7))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC39A7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC39 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids HDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC39A7 Blocking Peptide, catalog no. 33R-3709, is also available for use as a blocking control in assays to test for specificity of this SLC39A7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC39A7

Target: SLC39A7 (Solute Carrier Family 39 (Zinc Transporter), Member 7 (SLC39A7))

Andere Bezeichnung: SLC39A7 (SLC39A7 Produkte)

Synonyme: ke4 antikoerper, HKE4 antikoerper, id:ibd5081 antikoerper, wu:fc28c09 antikoerper, hke4 antikoerper, zip7 antikoerper, ring5 antikoerper, h2-ke4 antikoerper, d6s115e antikoerper, d6s2244e antikoerper, D6S115E antikoerper, D6S2244E antikoerper, H2-KE4 antikoerper, KE4 antikoerper, RING5 antikoerper, ZIP7 antikoerper, AA408174 antikoerper, AI117660 antikoerper, AL024048 antikoerper, H-2Ke4 antikoerper, H2-Ke4 antikoerper, Ke-4 antikoerper, Ke4 antikoerper, Ring5 antikoerper, Zip7 antikoerper, RT1-Ke4 antikoerper, Rt1Ke4 antikoerper, solute carrier family 39 (zinc transporter), member 7 antikoerper, solute carrier family 39 member 7 antikoerper, solute carrier family 39 member 7 L homeolog antikoerper, zinc transporter protein ZIP7 antikoerper, slc39a7 antikoerper, SLC39A7 antikoerper, slc39a7.L antikoerper, Slc39a7 antikoerper, zip7 antikoerper

Hintergrund: Zinc is an essential cofactor for more than 50 classes of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. Zinc cannot passively diffuse across cell membranes and requires specific transporters, such as SLC39A7, to enter the cytosol from both the extracellular environment and from intracellular storage compartments.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis