SLC39A10 Antikörper
-
- Target Alle SLC39A10 Antikörper anzeigen
- SLC39A10 (Solute Carrier Family 39 (Zinc Transporter), Member 10 (SLC39A10))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC39A10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC39 A10 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHRQHRGMTELEPSKFSKQAAENEKKYYIEKLFERYGENGRLSFFGLEKL
- Top Product
- Discover our top product SLC39A10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC39A10 Blocking Peptide, catalog no. 33R-5026, is also available for use as a blocking control in assays to test for specificity of this SLC39A10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC39A10 (Solute Carrier Family 39 (Zinc Transporter), Member 10 (SLC39A10))
- Andere Bezeichnung
- SLC39A10 (SLC39A10 Produkte)
- Synonyme
- LZT-Hs2 antikoerper, 2900042E17Rik antikoerper, 5430433I10 antikoerper, mKIAA1265 antikoerper, Slc39a10 antikoerper, Zip10 antikoerper, zgc:63552 antikoerper, DKFZp459C165 antikoerper, solute carrier family 39 member 10 antikoerper, solute carrier family 39 (zinc transporter), member 10 antikoerper, solute carrier family 39 (zinc transporter), member 4-like antikoerper, SLC39A10 antikoerper, Slc39a10 antikoerper, Slc39a4l antikoerper, slc39a10 antikoerper
- Hintergrund
- Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A10 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation.
- Molekulargewicht
- 94 kDa (MW of target protein)
-