G6PC Antikörper (N-Term)
-
- Target Alle G6PC Antikörper anzeigen
- G6PC (Glucose 6-Phosphatase, Catalytic (G6PC))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser G6PC Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- G6 PC antibody was raised against the N terminal of G6 C
- Aufreinigung
- Affinity purified
- Immunogen
- G6 PC antibody was raised using the N terminal of G6 C corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
- Top Product
- Discover our top product G6PC Primärantikörper
-
anti-Glucose 6-Phosphatase, Catalytic (G6PC) (N-Term) antibody
G6PC Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Glucose 6-Phosphatase, Catalytic (G6PC) (AA 123-149) antibodyG6PC Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB30027 unconjugated
anti-Glucose 6-Phosphatase, Catalytic (G6PC) (N-Term) antibodyG6PC Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Glucose 6-Phosphatase, Catalytic (G6PC) (AA 82-117) antibodyG6PC Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Glucose 6-Phosphatase, Catalytic (G6PC) antibodyG6PC Reaktivität: Human, Maus, Ratte ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
G6PC Blocking Peptide, catalog no. 33R-6784, is also available for use as a blocking control in assays to test for specificity of this G6PC antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 C antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- G6PC (Glucose 6-Phosphatase, Catalytic (G6PC))
- Andere Bezeichnung
- G6PC (G6PC Produkte)
- Synonyme
- AW107337 antikoerper, G6Pase antikoerper, G6pt antikoerper, Glc-6-Pase antikoerper, G6PC1 antikoerper, G6PT antikoerper, GSD1 antikoerper, GSD1a antikoerper, G-6-Pase antikoerper, glucose-6-phosphatase, catalytic antikoerper, glucose-6-phosphatase catalytic subunit antikoerper, glucose-6-phosphatase, catalytic subunit antikoerper, G6pc antikoerper, G6PC antikoerper
- Hintergrund
- G6PC hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- Carbohydrate Homeostasis, Cellular Glucan Metabolic Process
-
