CTDNEP1A Antikörper
-
- Target Alle CTDNEP1A Antikörper anzeigen
- CTDNEP1A (CTD Nuclear Envelope Phosphatase 1a (CTDNEP1A))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CTDNEP1A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DULLARD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW
- Top Product
- Discover our top product CTDNEP1A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DULLARD Blocking Peptide, catalog no. 33R-3807, is also available for use as a blocking control in assays to test for specificity of this DULLARD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DULLARD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CTDNEP1A (CTD Nuclear Envelope Phosphatase 1a (CTDNEP1A))
- Andere Bezeichnung
- DULLARD (CTDNEP1A Produkte)
- Synonyme
- Dullard antikoerper, 2610507E10Rik antikoerper, DULLARD antikoerper, HSA011916 antikoerper, NET56 antikoerper, dullard antikoerper, im:7137489 antikoerper, wu:fi48e07 antikoerper, zgc:92207 antikoerper, ctdnep1 antikoerper, dullard-b antikoerper, net56 antikoerper, CTD nuclear envelope phosphatase 1 antikoerper, CTD nuclear envelope phosphatase 1a antikoerper, CTD nuclear envelope phosphatase 1 L homeolog antikoerper, Ctdnep1 antikoerper, CTDNEP1 antikoerper, ctdnep1a antikoerper, ctdnep1.L antikoerper
- Hintergrund
- DULLARD is a serine/threonine phosphatase which may be required for proper nuclear membrane morphology. DULLARD was involved in LPIN1 dephosphorylation. It may antagonize BMP signaling.
- Molekulargewicht
- 28 kDa (MW of target protein)
-