RNF19A Antikörper (N-Term)

Produktnummer ABIN634836

Produktdetails anti-RNF19A Antikörper

Target: RNF19A (Ring Finger Protein 19A (RNF19A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF19A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF19 A antibody was raised against the N terminal of RNF19

Aufreinigung: Affinity purified

Immunogen: RNF19 A antibody was raised using the N terminal of RNF19 corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF19A Blocking Peptide, catalog no. 33R-3962, is also available for use as a blocking control in assays to test for specificity of this RNF19A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF19A

Target: RNF19A (Ring Finger Protein 19A (RNF19A))

Andere Bezeichnung: RNF19A (RNF19A Produkte)

Synonyme: RNF19 antikoerper, RNF19A antikoerper, AA032313 antikoerper, Dorfin antikoerper, Rnf19 antikoerper, UIP117 antikoerper, Ubce7ip2 antikoerper, XYbp antikoerper, ring finger protein 19A, RBR E3 ubiquitin protein ligase antikoerper, ring finger protein 19A antikoerper, RNF19A antikoerper, Rnf19a antikoerper

Hintergrund: RNF19A contains two RING-finger motifs and an IBR (in between RING fingers) motif. This protein is an E3 ubiquintin ligase that is localized in Lewy bodies (LBs), a characteristic neuronal inclusion in Parkinson's disease (PD) brains. This protein interacts with UBE2L3/UBCH7 and UBE2E2/UBCH8, but not other ubiquitin-conjugating enzymes. This protein is found to bind and ubiquitylate synphilin 1 (SNCAIP), which is a interacting protein of alpha synuclein in neurons, and a major component of LB.

Molekulargewicht: 91 kDa (MW of target protein)