Arylsulfatase H Antikörper (Middle Region)
-
- Target Alle Arylsulfatase H (ARSH) Antikörper anzeigen
- Arylsulfatase H (ARSH)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Arylsulfatase H Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ARSH antibody was raised against the middle region of ARSH
- Aufreinigung
- Affinity purified
- Immunogen
- ARSH antibody was raised using the middle region of ARSH corresponding to a region with amino acids FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG
- Top Product
- Discover our top product ARSH Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ARSH Blocking Peptide, catalog no. 33R-2924, is also available for use as a blocking control in assays to test for specificity of this ARSH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Arylsulfatase H (ARSH)
- Andere Bezeichnung
- ARSH (ARSH Produkte)
- Synonyme
- ARSH antikoerper, LOC100232370 antikoerper, sulfatase antikoerper, arylsulfatase family member H antikoerper, arylsulfatase D antikoerper, ARSH antikoerper, LOC100232370 antikoerper, LOC100229427 antikoerper
- Hintergrund
- Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.
- Molekulargewicht
- 63 kDa (MW of target protein)
-