SLC43A2 Antikörper (N-Term)

Produktnummer ABIN634843

Produktdetails anti-SLC43A2 Antikörper

Target: SLC43A2 (Solute Carrier Family 43, Member 2 (SLC43A2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC43A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC43 A2 antibody was raised against the N terminal of SLC43 2

Aufreinigung: Affinity purified

Immunogen: SLC43 A2 antibody was raised using the N terminal of SLC43 2 corresponding to a region with amino acids TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC43A2 Blocking Peptide, catalog no. 33R-9053, is also available for use as a blocking control in assays to test for specificity of this SLC43A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC43A2

Target: SLC43A2 (Solute Carrier Family 43, Member 2 (SLC43A2))

Andere Bezeichnung: SLC43A2 (SLC43A2 Produkte)

Synonyme: LAT4 antikoerper, lat4 antikoerper, MGC122003 antikoerper, 7630402D21Rik antikoerper, BC042513 antikoerper, Lat4 antikoerper, RGD1305819 antikoerper, si:dkey-118k5.2 antikoerper, slc43a2 antikoerper, zgc:56271 antikoerper, DKFZp469D1521 antikoerper, cb941 antikoerper, wu:fb37c04 antikoerper, wu:fb38e03 antikoerper, wu:fb52a10 antikoerper, wu:fi32b04 antikoerper, xx:lithzf000079 antikoerper, zgc:103664 antikoerper, solute carrier family 43 member 2 antikoerper, solute carrier family 43 (amino acid system L transporter), member 2 antikoerper, solute carrier family 43, member 2 antikoerper, solute carrier family 43 (amino acid system L transporter), member 2a antikoerper, solute carrier family 43 (amino acid system L transporter), member 2 L homeolog antikoerper, solute carrier family 43 (amino acid system L transporter), member 2b antikoerper, SLC43A2 antikoerper, slc43a2 antikoerper, Slc43a2 antikoerper, slc43a2a antikoerper, slc43a2.L antikoerper, slc43a2b antikoerper

Hintergrund: SLC43A2 is a Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids.

Molekulargewicht: 53 kDa (MW of target protein)