SIL1 Antikörper

Produktnummer ABIN634845

Produktdetails anti-SIL1 Antikörper

Target: SIL1 (Nucleotide Exchange Factor SIL1 (SIL1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SIL1 Blocking Peptide, catalog no. 33R-4531, is also available for use as a blocking control in assays to test for specificity of this SIL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SIL1

Target: SIL1 (Nucleotide Exchange Factor SIL1 (SIL1))

Andere Bezeichnung: SIL1 (SIL1 Produkte)

Synonyme: 1810057E01Rik antikoerper, AI042831 antikoerper, wz antikoerper, BAP antikoerper, MSS antikoerper, ULG5 antikoerper, endoplasmic reticulum chaperone SIL1 homolog (S. cerevisiae) antikoerper, SIL1 nucleotide exchange factor L homeolog antikoerper, SIL1 nucleotide exchange factor antikoerper, Sil1 antikoerper, sil1.L antikoerper, SIL1 antikoerper

Hintergrund: SIL1 is a resident endoplasmic reticulum (ER), N-linked glycoprotein with an N-terminal ER targeting sequence, 2 putative N-glycosylation sites, and a C-terminal ER retention signal. This protein functions as a nucleotide exchange factor for another unfolded protein response protein. Mutations in its gene have been associated with Marinesco-Sjogren syndrome.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Unfolded Protein Response, SARS-CoV-2 Protein Interaktom