PARP16 Antikörper
-
- Target Alle PARP16 Antikörper anzeigen
- PARP16 (Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PARP16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PARP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWD
- Top Product
- Discover our top product PARP16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PARP16 Blocking Peptide, catalog no. 33R-4620, is also available for use as a blocking control in assays to test for specificity of this PARP16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARP16 (Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16))
- Andere Bezeichnung
- PARP16 (PARP16 Produkte)
- Synonyme
- PARP16 antikoerper, zgc:77744 antikoerper, ARTD15 antikoerper, C15orf30 antikoerper, pART15 antikoerper, BC055447 antikoerper, C79952 antikoerper, PARP-16 antikoerper, LRRGT00109 antikoerper, RGD1306243 antikoerper, poly(ADP-ribose) polymerase family member 16 antikoerper, poly(ADP-ribose) polymerase family member 16 L homeolog antikoerper, poly (ADP-ribose) polymerase family, member 16 antikoerper, PARP16 antikoerper, parp16.L antikoerper, parp16 antikoerper, Parp16 antikoerper
- Hintergrund
- Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly(ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks.
- Molekulargewicht
- 36 kDa (MW of target protein)
-