PDE3A Antikörper (N-Term)
-
- Target Alle PDE3A Antikörper anzeigen
- PDE3A (phosphodiesterase 3A, cGMP-Inhibited (PDE3A))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PDE3A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PDE3 A antibody was raised against the N terminal of PDE3
- Aufreinigung
- Affinity purified
- Immunogen
- PDE3 A antibody was raised using the N terminal of PDE3 corresponding to a region with amino acids LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD
- Top Product
- Discover our top product PDE3A Primärantikörper
-
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) antibody
PDE3A Reaktivität: Human, Ratte, Maus IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (AA 533-640) antibodyPDE3A Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 2D7 unconjugated
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (AA 380-660) antibodyPDE3A Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (AA 948-1141) antibodyPDE3A Reaktivität: Ratte WB, IP, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (AA 533-640) antibodyPDE3A Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 5C12 unconjugated
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (Internal Region) antibodyPDE3A Reaktivität: Human, Ratte, Maus, Affe, Pferd IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (AA 533-640) antibodyPDE3A Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-phosphodiesterase 3A, cGMP-Inhibited (PDE3A) (AA 360-409) antibodyPDE3A Reaktivität: Human, Affe, Rind (Kuh), Schwein, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PDE3A Blocking Peptide, catalog no. 33R-5115, is also available for use as a blocking control in assays to test for specificity of this PDE3A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDE3A (phosphodiesterase 3A, cGMP-Inhibited (PDE3A))
- Andere Bezeichnung
- PDE3A (PDE3A Produkte)
- Synonyme
- PDE3A antikoerper, Pde3a antikoerper, si:dkey-48h7.2 antikoerper, A930022O17Rik antikoerper, C87899 antikoerper, RNPDE3A antikoerper, CGI-PDE antikoerper, CGI-PDE A antikoerper, CGI-PDE-A antikoerper, phosphodiesterase 3A antikoerper, phosphodiesterase 3A, cGMP-inhibited antikoerper, cGMP-inhibited 3',5'-cyclic phosphodiesterase A antikoerper, phosphodiesterase 3A, cGMP inhibited antikoerper, PDE3A antikoerper, Pde3a antikoerper, LOC100540515 antikoerper, pde3a antikoerper
- Hintergrund
- PDE3A belongs to the cyclic nucleotide phosphodiesterase family. It hydrolyzes both cyclic AMP (cAMP) and cyclic GMP (cGMP).
- Molekulargewicht
- 125 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-
