SLC23A2 Antikörper
-
- Target Alle SLC23A2 Antikörper anzeigen
- SLC23A2 (Solute Carrier Family 23 (Nucleobase Transporters), Member 2 (SLC23A2))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC23A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC23 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK
- Top Product
- Discover our top product SLC23A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC23A2 Blocking Peptide, catalog no. 33R-9424, is also available for use as a blocking control in assays to test for specificity of this SLC23A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC23A2 (Solute Carrier Family 23 (Nucleobase Transporters), Member 2 (SLC23A2))
- Andere Bezeichnung
- SLC23A2 (SLC23A2 Produkte)
- Hintergrund
- The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.
- Molekulargewicht
- 70 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-