SLC23A2 Antikörper

Produktnummer ABIN634854

Produktdetails anti-SLC23A2 Antikörper

Target: SLC23A2 (Solute Carrier Family 23 (Nucleobase Transporters), Member 2 (SLC23A2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC23A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC23 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC23A2 Blocking Peptide, catalog no. 33R-9424, is also available for use as a blocking control in assays to test for specificity of this SLC23A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC23A2

Target: SLC23A2 (Solute Carrier Family 23 (Nucleobase Transporters), Member 2 (SLC23A2))

Andere Bezeichnung: SLC23A2 (SLC23A2 Produkte)

Synonyme: NBTL1 antikoerper, SLC23A1 antikoerper, SVCT2 antikoerper, YSPL2 antikoerper, SLC23A2 antikoerper, AI844736 antikoerper, Slc23a1 antikoerper, YSPL3 antikoerper, mKIAA0238 antikoerper, solute carrier family 23 member 2 antikoerper, solute carrier family 23 (nucleobase transporters), member 2 antikoerper, SLC23A2 antikoerper, Slc23a2 antikoerper

Hintergrund: The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development