Glycoprotein Antikörper

Produktnummer ABIN634855

Produktdetails

Target: Glycoprotein

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Glycoprotein Blocking Peptide, catalog no. 33R-1947, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPNMB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Glycoprotein

Synonyme: glycoprotein antikoerper, Glycoprotein antikoerper, transmembrane glycoprotein G antikoerper, G antikoerper, RVFV_sM_gp1 antikoerper, RABVgp4 antikoerper

Substanzklasse: Viral Protein

Hintergrund: GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts.

Molekulargewicht: 62 kDa (MW of target protein)