RNF170 Antikörper (C-Term)

Produktnummer ABIN634858

Produktdetails anti-RNF170 Antikörper

Target: RNF170 (Ring Finger Protein 170 (RNF170))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF170 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF170 antibody was raised against the C terminal of RNF170

Aufreinigung: Affinity purified

Immunogen: RNF170 antibody was raised using the C terminal of RNF170 corresponding to a region with amino acids FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF170 Blocking Peptide, catalog no. 33R-3138, is also available for use as a blocking control in assays to test for specificity of this RNF170 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF170 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF170

Target: RNF170 (Ring Finger Protein 170 (RNF170))

Andere Bezeichnung: RNF170 (RNF170 Produkte)

Synonyme: SNAX1 antikoerper, 6720407G21Rik antikoerper, AI481227 antikoerper, ring finger protein 170 antikoerper, ring finger protein 170 L homeolog antikoerper, microRNA 4469 antikoerper, Rnf170 antikoerper, RNF170 antikoerper, rnf170.L antikoerper, MIR4469 antikoerper

Hintergrund: RNF170 is a multi-pass membrane proteinPotential. It contains 1 RING-type zinc finger. The exact function of RNF170 remains unknown.

Molekulargewicht: 30 kDa (MW of target protein)