ENTPD7 Antikörper (C-Term)
-
- Target Alle ENTPD7 Antikörper anzeigen
- ENTPD7 (Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ENTPD7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ENTPD7 antibody was raised against the C terminal of ENTPD7
- Aufreinigung
- Affinity purified
- Immunogen
- ENTPD7 antibody was raised using the C terminal of ENTPD7 corresponding to a region with amino acids EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAIL
- Top Product
- Discover our top product ENTPD7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ENTPD7 Blocking Peptide, catalog no. 33R-2459, is also available for use as a blocking control in assays to test for specificity of this ENTPD7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENTPD7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ENTPD7 (Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7))
- Andere Bezeichnung
- ENTPD7 (ENTPD7 Produkte)
- Hintergrund
- ENTPD7 is a multi-pass membrane protein.It belongs to the GDA1/CD39 NTPase family. It preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP > GTP > CTP.
- Molekulargewicht
- 69 kDa (MW of target protein)
-