ENTPD7 Antikörper (C-Term)

Produktnummer ABIN634874

Produktdetails anti-ENTPD7 Antikörper

Target: ENTPD7 (Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ENTPD7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ENTPD7 antibody was raised against the C terminal of ENTPD7

Aufreinigung: Affinity purified

Immunogen: ENTPD7 antibody was raised using the C terminal of ENTPD7 corresponding to a region with amino acids EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ENTPD7 Blocking Peptide, catalog no. 33R-2459, is also available for use as a blocking control in assays to test for specificity of this ENTPD7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENTPD7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ENTPD7

Target: ENTPD7 (Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7))

Andere Bezeichnung: ENTPD7 (ENTPD7 Produkte)

Synonyme: LALP1 antikoerper, NTPDase7 antikoerper, RP11-483F11.1 antikoerper, 1810012B13Rik antikoerper, 1810020C02Rik antikoerper, 2810003F23Rik antikoerper, Lysal2 antikoerper, ectonucleoside triphosphate diphosphohydrolase 7 antikoerper, ectonucleoside triphosphate diphosphohydrolase 7 L homeolog antikoerper, ENTPD7 antikoerper, entpd7 antikoerper, entpd7.L antikoerper, Entpd7 antikoerper

Hintergrund: ENTPD7 is a multi-pass membrane protein.It belongs to the GDA1/CD39 NTPase family. It preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP > GTP > CTP.

Molekulargewicht: 69 kDa (MW of target protein)